| IED ID | IndEnz0002002609 |
| Enzyme Type ID | protease002609 |
| Protein Name |
Annexin A2 Annexin II Annexin-2 Calpactin I heavy chain Calpactin-1 heavy chain Chromobindin-8 Lipocortin II Placental anticoagulant protein IV PAP-IV Protein I p36 |
| Gene Name | ANXA2 ANX2 |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | MSTVHEILCKLSLEGDHSTPASAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIXIMVSRSEVDMLKIRSEFKRKYGKSLYNYIQQDTKGDYQKALLYLCGGDD |
| Enzyme Length | 339 |
| Uniprot Accession Number | P19620 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9. {ECO:0000250|UniProtKB:P07355}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Cross-link (2); Initiator methionine (1); Modified residue (8); Region (1); Repeat (4); Sequence conflict (3) |
| Keywords | Acetylation;Annexin;Basement membrane;Calcium;Calcium/phospholipid-binding;Direct protein sequencing;Extracellular matrix;Isopeptide bond;Phosphoprotein;Reference proteome;Repeat;Secreted;Ubl conjugation |
| Interact With | Q9YS30 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix, basement membrane. Melanosome {ECO:0000250}. Note=In the lamina beneath the plasma membrane. |
| Modified Residue | MOD_RES 2; /note=N-acetylserine; /evidence=ECO:0000269|PubMed:17607745; MOD_RES 24; /note=Phosphotyrosine; by SRC; /evidence=ECO:0000250|UniProtKB:P07355; MOD_RES 26; /note=Phosphoserine; by PKC; /evidence=ECO:0000250|UniProtKB:P07355; MOD_RES 49; /note=N6-acetyllysine; alternate; /evidence=ECO:0000250|UniProtKB:P07356; MOD_RES 152; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P07356; MOD_RES 184; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P07355; MOD_RES 199; /note=Phosphotyrosine; /evidence=ECO:0000250|UniProtKB:P07356; MOD_RES 227; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P07356 |
| Post Translational Modification | PTM: ISGylated. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,534 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |