Detail Information for IndEnz0002002615
IED ID IndEnz0002002615
Enzyme Type ID protease002615
Protein Name Aspartic protease 1
EC 3.4.23.-
Gene Name asp-1 Y39B6A.20
Organism Caenorhabditis elegans
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans
Enzyme Sequence MQTFVLLALVAACSAAVIQVPTHKTESLRAKLIKEGKYTAFLASQHAARAQQLNTGFQPFVDYFDDFYLGNITLGTPPQPATVVLDTGSSNLWVIDAACKTQACNGYPDSGYTKQKFDTTKSTTFVKETRKFSIQYGSGSCNGYLGKDVLNFGGLTVQSQEFGVSTHLADVFGYQPVDGILGLGWPALAVDQVVPPMQNLIAQKQLDAPLFTVWLDRNLQIAQGTPGGLITYGAIDTVNCAKQVTYVPLSAKTYWQFPLDAFAVGTYSETKKDQVISDTGTSWLGAPNTIVSAIVKQTKAVFDWSTELYTVDCSTMKTQPDLIFTIGGAQFPVKSVEYVLDLQLGGGKCALAVFSMGSGGFGPSWILGDTFIRQYCNVYDIGNGQIGFATAVHKGL
Enzyme Length 396
Uniprot Accession Number G5EEI4
Absorption
Active Site ACT_SITE 86; /evidence=ECO:0000255|PROSITE-ProRule:PRU01103; ACT_SITE 278; /evidence=ECO:0000255|PROSITE-ProRule:PRU01103
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.4.23.-
Enzyme Function FUNCTION: Aspartic protease, which is part of the necrosis cell death pathway (PubMed:26795495, PubMed:12410314). Promotes B.thuringiensis Cry6Aa stability by preventing its proteolysis by host gut proteases. Required for Cry6Aa-induced necrotic death of intestinal cells (PubMed:26795495). Cry6Aa uptake into the host intestinal cells triggers an increase in intracellular Ca(2+) levels leading to lysosome rupture and to the subsequent release of asp-1 which leads to necrosis (PubMed:26795495). {ECO:0000269|PubMed:12410314, ECO:0000269|PubMed:26795495}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (2); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Sequence conflict (2); Signal peptide (1)
Keywords Aspartyl protease;Cytoplasm;Disulfide bond;Glycoprotein;Hydrolase;Lysosome;Necrosis;Protease;Reference proteome;Secreted;Signal
Interact With
Induction INDUCTION: Up-regulated by B.thuringiensis endotoxin Cry6Aa (at protein level). {ECO:0000269|PubMed:26795495}.
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10854422}. Lysosome {ECO:0000305|PubMed:10854422}. Secreted {ECO:0000305}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..15; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 11559592; 14704431; 15990870; 16854972; 17164286; 17486083; 17889653; 19123269; 19343510; 21110867; 21177967; 22347378; 22560298; 23800452; 25487147; 26351692; 27506200; 31216475;
Motif
Gene Encoded By
Mass 42,693
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda