| IED ID | IndEnz0002002624 |
| Enzyme Type ID | protease002624 |
| Protein Name |
Cathepsin B-like cysteine proteinase EC 3.4.22.- Newly excysted juvenile proteins 5 and 7 Fragments |
| Gene Name | |
| Organism | Fasciola hepatica (Liver fluke) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Platyhelminthes Trematoda Digenea (flukes) Plagiorchiida Echinostomata Echinostomatoidea Fasciolidae Fasciola Fasciola hepatica (Liver fluke) |
| Enzyme Sequence | KPNYKRQFEPFSDELIHYINLEDLPESFDARQ |
| Enzyme Length | 32 |
| Uniprot Accession Number | P80529 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Thiol protease. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (1); Non-terminal residue (1); Propeptide (1) |
| Keywords | Direct protein sequencing;Hydrolase;Protease;Thiol protease;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,940 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |