| IED ID | IndEnz0002002680 |
| Enzyme Type ID | protease002680 |
| Protein Name |
Serine protease inhibitor Kazal-type 1 P12 Prostatic secretory glycoprotein Serine protease inhibitor Kazal-type 3 |
| Gene Name | Spink1 Spink3 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MKVAVIFLLSALALLSLAGNTFSAKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC |
| Enzyme Length | 80 |
| Uniprot Accession Number | P09036 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:3428272, PubMed:14645103, PubMed:22228629). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens (PubMed:16083722). {ECO:0000269|PubMed:14645103, ECO:0000269|PubMed:16083722, ECO:0000269|PubMed:22228629, ECO:0000269|PubMed:3428272}.; FUNCTION: In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production (PubMed:9828198, PubMed:14645103, PubMed:16083722, PubMed:22228629). {ECO:0000269|PubMed:14645103, ECO:0000269|PubMed:16083722, ECO:0000269|PubMed:22228629, ECO:0000269|PubMed:9828198}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Mutagenesis (6); Signal peptide (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | INDUCTION: By androgens in adult male sex accessory glands. Expressed constitutively in pancreas. {ECO:0000269|PubMed:3428272}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:1929395}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 14659016; 15097871; 17683524; 18386042; 18554416; 18715980; 20003319; 20110462; 20157294; 20623140; 20660988; 21267068; 21677750; 22008794; 22042864; 22260730; 2430282; 24521862; 24607897; 25063451; 26682926; 28049832; 29463648; 30831323; 30959855; 31923181; 32179912; 3399394; 9507200; |
| Motif | |
| Gene Encoded By | |
| Mass | 8,488 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |