| IED ID | IndEnz0002002687 |
| Enzyme Type ID | protease002687 |
| Protein Name |
Proteinase inhibitor A Double-headed proteinase inhibitor A API-A |
| Gene Name | |
| Organism | Sagittaria sagittifolia (Arrowhead) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Alismatales Alismataceae Sagittaria Sagittaria sagittifolia (Arrowhead) |
| Enzyme Sequence | MAASNALLLISGVLLISLAVLCHGDPVVDSDGDAVQLNLGGNYPLYTIQSAAIGFRGGLSTLHKDACKSYVYEAPETDRGLPVGFSASATSQPVMQLGSRYKFSFSMPVPLICDTAWSIGKSTEETGVYKLAACSCEFCKIACPEVGSFNVNGRTLLGIGGEHFTVRFQKFDALAMKTAPQ |
| Enzyme Length | 181 |
| Uniprot Accession Number | P31608 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Possesses two reactive sites. Inhibits an equimolar amount of trypsin and chymotrypsin simultaneously, and inhibits kallikrein weakly. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Sequence conflict (5); Signal peptide (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:1618743 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,152 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |