| IED ID | IndEnz0002002724 |
| Enzyme Type ID | protease002724 |
| Protein Name |
Kallikrein-1 EC 3.4.21.35 Kidney/pancreas/salivary gland kallikrein Tissue kallikrein |
| Gene Name | KLK1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS |
| Enzyme Length | 262 |
| Uniprot Accession Number | P06870 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; ACT_SITE 120; /note=Charge relay system; ACT_SITE 214; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.; EC=3.4.21.35; |
| DNA Binding | |
| EC Number | 3.4.21.35 |
| Enzyme Function | FUNCTION: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (1); Beta strand (15); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (6); Helix (5); Natural variant (4); Propeptide (1); Sequence conflict (4); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: The O-linked polysaccharides on Ser-93, Ser-104 and Ser-167 are probably the mucin type linked to GalNAc. In PubMed:3163150, GalNAc was detected with the corresponding peptides but not located. {ECO:0000269|PubMed:15651049, ECO:0000269|PubMed:3163150}. |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000305 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1SPJ; |
| Mapped Pubmed ID | 10218588; 11130770; 11727832; 11751371; 11849458; 11913965; 12379487; 12466191; 12581867; 12670744; 12887060; 1383255; 14660481; 14988406; 15086490; 15167446; 15364809; 15544850; 15611141; 15662224; 15855348; 15905889; 16129698; 16465461; 16957554; 17047378; 17050061; 17671125; 17699431; 17761919; 17762646; 17804733; 18182238; 18283336; 18327081; 18359858; 18402547; 18577888; 18627303; 18689794; 18713009; 18725990; 18844446; 19082699; 19232384; 19423540; 19558318; 19578768; 19913121; 20143645; 20225398; 20406964; 20424135; 20438785; 20516044; 20533273; 20536386; 20613781; 20628086; 21164105; 21200088; 21211543; 21571276; 21679467; 21823154; 23635481; 23697984; 23765970; 23874198; 24005896; 24530396; 24586431; 24599937; 24626253; 25100328; 25448306; 26677174; 27329205; 27618014; 27858843; 28322037; 28621557; 30618416; 30801944; 30908937; 31873176; 33355364; 33397811; 7525634; 7525824; 7538844; 8817670; 9857240; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,890 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.35; |