| IED ID | IndEnz0002002730 |
| Enzyme Type ID | protease002730 |
| Protein Name |
Alpha-1-antiproteinase 4 Alpha-1-antitrypsin 4 Alpha-1-proteinase inhibitor 4 SPI4 Fragments |
| Gene Name | |
| Organism | Equus caballus (Horse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Perissodactyla (odd-toed ungulates) Equidae (horses) Equus Equus Equus caballus (Horse) |
| Enzyme Sequence | EDLQGTAVQERSAKASDEEEAIRTLLLTNVEFNRPFVLSIYDR |
| Enzyme Length | 43 |
| Uniprot Accession Number | P38031 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (1); Non-terminal residue (1); Site (1) |
| Keywords | Acute phase;Direct protein sequencing;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated with carbohydrates having biantennary side chains. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,925 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |