| IED ID | IndEnz0002002752 |
| Enzyme Type ID | protease002752 |
| Protein Name |
Major capsid protein Gene product 5 Gene product E Major head protein |
| Gene Name | E 5 |
| Organism | Enterobacteria phage phi80 (Bacteriophage phi-80) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Siphoviridae (phages with long non-contractile tails) unclassified Siphoviridae Enterobacteria phage phi80 (Bacteriophage phi-80) |
| Enzyme Sequence | MSVYTTAQLLAVNEKKFKFDPLFLRIFFRETYPFSTEKVYLSQIPGLVNMALYVSPIVSGKVIRSRGGSTSEFTPGYVKPKHEVNPLMMTLRLPDEDPQNVADPVYRRRRIILQNMKDEELAIAQVEEKQAVSAVLSGKYTMTGEAFEPVEVDMGRSAGNNIVQAGAAAWSTRDKETYDPTDDIEAYALNARGVVNIIVFDPKGWALFRSFKAVEKKLDTRRGSNSELETAVKDLGMAVSYKGMFGDVAIVVYSGQYVENDVKKNYLPDLTMVLGNTQARGLRTYGCILDADAQREGIDASTRYPKNWVQLGDPVREFTMIQSAPLMLLPDPDAFVSVKLA |
| Enzyme Length | 341 |
| Uniprot Accession Number | P05481 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Assembles to form an icosahedral capsid with a T=7 symmetry. The icosahedral capsid is about 60 nm in diameter and composed of 415 major capsid proteins. The assembly is primed by the interaction between capsid assembly protease and portal dodecamer, and major capsid proteins assemble cooperatively to form the procapsid with the help of capsid scaffolding protein. Major capsid protein forms hexons and pentons of the icosahedron. Viral genomic DNA is packaged into the procapsid through the portal vertex. The packaging triggers a dramatic reconfiguration of the capsid shell. {ECO:0000250|UniProtKB:P03713}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1) |
| Keywords | Capsid protein;Coiled coil;Host cytoplasm;Late protein;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000255|HAMAP-Rule:MF_04133}. Host cytoplasm {ECO:0000255|HAMAP-Rule:MF_04133}. Note=Forms the capsid icosahedric shell. {ECO:0000255|HAMAP-Rule:MF_04133}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,055 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |