| IED ID | IndEnz0002002754 |
| Enzyme Type ID | protease002754 |
| Protein Name |
Caspase recruitment domain-containing protein 18 Caspase-1 inhibitor Iceberg |
| Gene Name | CARD18 ICEBERG UNQ5804/PRO19611 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH |
| Enzyme Length | 90 |
| Uniprot Accession Number | P57730 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B. {ECO:0000269|PubMed:11051551}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Helix (7) |
| Keywords | 3D-structure;Protease inhibitor;Reference proteome;Thiol protease inhibitor |
| Interact With | P29466 |
| Induction | INDUCTION: Up-regulated in response to TNF and bacterial lipopolysaccharides (LPS). {ECO:0000269|PubMed:11051551}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1DGN; |
| Mapped Pubmed ID | 21048031; 23948415; 27023378; 28506683; |
| Motif | |
| Gene Encoded By | |
| Mass | 10,138 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |