| IED ID | IndEnz0002002757 |
| Enzyme Type ID | protease002757 |
| Protein Name |
Putative AgrB-like protein EC 3.4.-.- |
| Gene Name | CA_C0078 |
| Organism | Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Clostridia Eubacteriales Clostridiaceae Clostridium Clostridium acetobutylicum Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) |
| Enzyme Sequence | MKGKSSVMEKLAEVVSLKLNKHLKMEGIELIKLKLGVEIIFINISKLAILFLVSYYFGLIKETIIMLAAFGFLRSNAFGLHAKNSIVCTVMSLLMFVLGAYLSKYLLFNNYMVLASFIIVNLLLFRYAPGDTEAHPLVGAKLRDKLKKQAVLMGMLLMAITLIIPDELIKTCISLSSYFEIISILPITYKVLGRRYKNYYEFERTIKQS |
| Enzyme Length | 209 |
| Uniprot Accession Number | Q97MW3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: May be involved in the proteolytic processing of a quorum sensing system signal molecule precursor. {ECO:0000255|HAMAP-Rule:MF_00784}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (5) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Quorum sensing;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|HAMAP-Rule:MF_00784}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00784}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,750 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |