| IED ID | IndEnz0002002762 |
| Enzyme Type ID | protease002762 |
| Protein Name |
Chaperone protein caf1M Capsule protein fraction 1 |
| Gene Name | caf1M YPMT1.82 Y1098 YP_pMT084 |
| Organism | Yersinia pestis |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia pseudotuberculosis complex Yersinia pestis |
| Enzyme Sequence | MILNRLSTLGIITFGMLSFAANSAQPDIKFASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDEDIWVDDATNKQKFNPDKDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPKGLAGARNVSWRIINDQGGLDRLYSKNVTL |
| Enzyme Length | 258 |
| Uniprot Accession Number | P26926 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has a stimulatory role for the envelope antigen F1 secretion. It seems to interact with the subunit polypeptide and to prevent it from digestion by a protease. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (21); Chain (1); Disulfide bond (1); Erroneous initiation (2); Helix (3); Sequence conflict (1); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Chaperone;Disulfide bond;Immunoglobulin domain;Periplasm;Plasmid;Reference proteome;Signal |
| Interact With | P26948 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (11) |
| Cross Reference PDB | 1P5U; 1P5V; 1Z9S; 2OS7; 3DOS; 3DPB; 3DSN; 4AY0; 4AYF; 4AZ8; 4B0M; |
| Mapped Pubmed ID | 12787500; 15799718; 17376079; 20711500; 22981947; |
| Motif | |
| Gene Encoded By | Plasmid pMT1,pMT-1; Plasmid pFra |
| Mass | 28,751 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |