| IED ID | IndEnz0002002780 |
| Enzyme Type ID | protease002780 |
| Protein Name |
Pre-protein VI pVI Cleaved into: Endosome lysis protein; Protease cofactor pVI-C |
| Gene Name | L3 |
| Organism | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human mastadenovirus C Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) |
| Enzyme Sequence | MEDINFASLAPRHGSRPFMGNWQDIGTSNMSGGAFSWGSLWSGIKNFGSTVKNYGSKAWNSSTGQMLRDKLKEQNFQQKVVDGLASGISGVVDLANQAVQNKINSKLDPRPPVEEPPPAVETVSPEGRGEKRPRPDREETLVTQIDEPPSYEEALKQGLPTTRPIAPMATGVLGQHTPVTLDLPPPADTQQKPVLPGPTAVVVTRPSRASLRRAASGPRSLRPVASGNWQSTLNSIVGLGVQSLKRRRCF |
| Enzyme Length | 250 |
| Uniprot Accession Number | P24937 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Pre-protein VI]: During virus assembly, promotes hexon trimers nuclear import through nuclear pore complexes via an importin alpha/beta-dependent mechanism. By analogy to herpesviruses capsid assembly, might act as a chaperone to promote the formation of the icosahedral capsid. {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:14633984}.; FUNCTION: [Endosome lysis protein]: Structural component of the virion that provides increased stability to the particle shell through its interaction with the core-capsid bridging protein and the hexon-linking protein VIII (PubMed:25071205). Fibers shedding during virus entry into host cell allows the endosome lysis protein to be exposed as a membrane-lytic peptide (By similarity). Exhibits pH-independent membrane fragmentation activity and probably mediates viral rapid escape from host endosome via organellar membrane lysis (PubMed:15681401, PubMed:21209115, PubMed:20409568, PubMed:22516138). It is not clear if it then remains partially associated with the capsid and involved in the intracellular microtubule-dependent transport of capsid to the nucleus, or if it is lost during endosomal penetration (PubMed:20333243). {ECO:0000250|UniProtKB:P03274, ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:15681401, ECO:0000269|PubMed:20333243, ECO:0000269|PubMed:20409568, ECO:0000269|PubMed:21209115, ECO:0000269|PubMed:22516138, ECO:0000269|PubMed:25071205}.; FUNCTION: [Protease cofactor]: Cofactor that activates the viral protease. Binds to viral protease in a 1:1 ratio. {ECO:0000255|HAMAP-Rule:MF_04048}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Compositional bias (1); Disulfide bond (1); Modified residue (2); Motif (5); Mutagenesis (3); Peptide (1); Propeptide (1); Region (6); Site (2) |
| Keywords | 3D-structure;Capsid protein;Cytoplasmic inwards viral transport;Disulfide bond;Host cytoplasm;Host nucleus;Host-virus interaction;Late protein;Microtubular inwards viral transport;Phosphoprotein;Ubl conjugation;Viral capsid assembly;Viral penetration into host cytoplasm;Viral penetration via lysis of host organellar membrane;Viral release from host cell;Virion;Virus entry into host cell |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000255|HAMAP-Rule:MF_04048}. |
| Subcellular Location | SUBCELLULAR LOCATION: [Pre-protein VI]: Host nucleus {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:14633984}. Host cytoplasm {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:14633984}. Note=Shuttles between host cytoplasm and nucleus. {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:14633984}.; SUBCELLULAR LOCATION: [Endosome lysis protein]: Virion {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:25071205}. Note=Associates with the base of each peripentonal hexon on the capsid interior. Present in around 360 copies per virion. {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:25071205}. |
| Modified Residue | MOD_RES 124; /note=Phosphoserine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04048; MOD_RES 143; /note=Phosphothreonine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04048 |
| Post Translational Modification | PTM: Ubiquitinated by Nedd4 following partial capsid disassembly; which might play a role in intracellular virus movement during entry. {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:20333243}.; PTM: [Protease cofactor]: Contains the major nuclear import and export signals. Proteolytically removed during virion maturation. The processing of the C-terminus turns the precursor into a mature viral structural protein and abrogates its ability to promote hexon import and act as a potential chaperone protein. {ECO:0000255|HAMAP-Rule:MF_04048, ECO:0000269|PubMed:14633984}. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6CGV; |
| Mapped Pubmed ID | 30121295; |
| Motif | MOTIF 67..76; /note=Nuclear export signal; /evidence=ECO:0000255|HAMAP-Rule:MF_04048; MOTIF 131..135; /note=Nuclear localization signal; /evidence=ECO:0000255|HAMAP-Rule:MF_04048; MOTIF 148..151; /note=PPXY motif; /evidence=ECO:0000255|HAMAP-Rule:MF_04048; MOTIF 231..242; /note=Nuclear export signal; /evidence=ECO:0000255|HAMAP-Rule:MF_04048; MOTIF 245..248; /note=Nuclear localization signal; /evidence=ECO:0000255|HAMAP-Rule:MF_04048 |
| Gene Encoded By | |
| Mass | 26,996 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |