| IED ID | IndEnz0002002838 |
| Enzyme Type ID | protease002838 |
| Protein Name |
Putative movement protein EC 3.4.21.- 36 kDa protein ORF2 protein |
| Gene Name | |
| Organism | Apple stem grooving virus (strain Korea) (ASGV) |
| Taxonomic Lineage | Viruses Riboviria Orthornavirae Kitrinoviricota Alsuviricetes Tymovirales Betaflexiviridae Trivirinae Capillovirus Apple stem grooving virus Apple stem grooving virus (strain Korea) (ASGV) |
| Enzyme Sequence | MAIVNVNHFLKEVESTDLKIDAIASSELYKDATFFKPDVLNCIKRFESNVKVSQGQGDGLVLSDFKLLDDTEIDSIRKKSNKYKYLHYGVILVGIKAMLPNFRGMEGRVIVYDGACLDPERGHICSYLFRFESDCCYFGLRPEHCLSTTDVNLAKRFRFRVDFDCPQYEQDTELFALDIGVAYRCVNSARFLETKTGDSGWASQAISGCEALKYNEEIKMAILDHKSPLFLEEGAPNVHIEKRMFRGDKIRRSRSISAKRGPNSRSKETRGFRSLSARIERFGKDEFGRRASTSEAPPGRSVSVEDTDRPGKGNSDGSSP |
| Enzyme Length | 320 |
| Uniprot Accession Number | P0C1U3 |
| Absorption | |
| Active Site | ACT_SITE 144; /evidence=ECO:0000255; ACT_SITE 171; /evidence=ECO:0000255; ACT_SITE 199; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: May play a role in viral cell to cell movement by increasing the size exclusion limit of plasmodesmata and forming a complex with viral RNA to assist its movement (By similarity). May also have a papain-like protease activity and cleave the genome polyprotein. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Compositional bias (1); Region (1) |
| Keywords | Hydrolase;RNA-binding;Transport;Viral movement protein |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 36,093 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |