| IED ID | IndEnz0002002844 |
| Enzyme Type ID | protease002844 |
| Protein Name |
Basic secretory protease EC 3.4.24.- Boswellia basic secretory protease BBSP Fragments |
| Gene Name | |
| Organism | Boswellia serrata (Indian frankincense) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Sapindales Burseraceae Boswellia Boswellia serrata (Indian frankincense) |
| Enzyme Sequence | YSLQNDPEITLIDSTIEWDEGYDVTARFLDYLNSLDAGFVAELENKTVEQLWSEYKASYGPNGQ |
| Enzyme Length | 64 |
| Uniprot Accession Number | C0HJG8 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by EDTA. {ECO:0000269|PubMed:22773449}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Metalloprotease, digests gelatin and azocasein (in vitro). {ECO:0000269|PubMed:22773449}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (4); Non-terminal residue (2) |
| Keywords | Direct protein sequencing;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000269|PubMed:22773449}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,324 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |