| IED ID | IndEnz0002002846 |
| Enzyme Type ID | protease002846 |
| Protein Name |
B2 bradykinin receptor B2R BK-2 receptor |
| Gene Name | Bdkrb2 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MDTRSSLCPKTQAVVAVFWGPGCHLSTCIEMFNITTQALGSAHNGTFSEVNCPDTEWWSWLNAIQAPFLWVLFLLAALENIFVLSVFCLHKTNCTVAEIYLGNLAAADLILACGLPFWAITIANNFDWLFGEVLCRVVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWSCTLLLSSPMLVFRTMKDYREEGHNVTACVIVYPSRSWEVFTNMLLNLVGFLLPLSIITFCTVRIMQVLRNNEMKKFKEVQTEKKATVLVLAVLGLFVLCWFPFQISTFLDTLLRLGVLSGCWNERAVDIVTQISSYVAYSNSCLNPLVYVIVGKRFRKKSREVYQAICRKGGCMGESVQMENSMGTLRTSISVDRQIHKLQDWAGNKQ |
| Enzyme Length | 396 |
| Uniprot Accession Number | P25023 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Disulfide bond (1); Glycosylation (3); Lipidation (1); Modified residue (7); Sequence conflict (2); Topological domain (8); Transmembrane (7) |
| Keywords | Alternative splicing;Cell membrane;Direct protein sequencing;Disulfide bond;G-protein coupled receptor;Glycoprotein;Lipoprotein;Membrane;Palmitate;Phosphoprotein;Receptor;Reference proteome;Transducer;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. |
| Modified Residue | MOD_RES 161; /note=Phosphotyrosine; /evidence=ECO:0000269|PubMed:10085087; MOD_RES 352; /note=Phosphotyrosine; /evidence=ECO:0000269|PubMed:10085087; MOD_RES 365; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:10085087; MOD_RES 371; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:10085087; MOD_RES 374; /note=Phosphothreonine; /evidence=ECO:0000269|PubMed:10085087; MOD_RES 378; /note=Phosphoserine; by GRK6; /evidence=ECO:0000269|PubMed:10085087; MOD_RES 380; /note=Phosphoserine; by GRK6; /evidence=ECO:0000269|PubMed:10085087 |
| Post Translational Modification | PTM: Diphosphorylation at Ser-365 and Ser-371, at Ser-378 and Ser-380, and at Thr-374 and Ser-380 seem to be correlated pairwise.; PTM: Palmitoylation at Cys-356 and phosphorylation at Tyr-352 seem to be mutually exclusive. {ECO:0000269|PubMed:10085087}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10188975; 10702448; 11686492; 11934804; 12025958; 12025970; 12177051; 12435802; 12444060; 12489796; 12558524; 12558526; 12623134; 12639805; 12694402; 12746865; 12791684; 12923406; 14727005; 14753436; 14766673; 14766794; 15001555; 15576455; 15607753; 15708952; 15878794; 16138314; 16507603; 16513137; 16754789; 18182225; 18190998; 18264983; 18302192; 18632797; 19017652; 19027830; 19300402; 19544046; 19565561; 19889854; 19950773; 19954757; 20080302; 20150590; 20198577; 20345876; 20531238; 20637711; 20883789; 21232147; 21986469; 22739815; 22862305; 22877648; 23306173; 23417862; 23735753; 23982204; 24025224; 24724708; 25713410; 25955317; 26256678; 26565562; 27628189; 30580020; 31086419; 33687297; 7791078; 9208140; |
| Motif | |
| Gene Encoded By | |
| Mass | 44,930 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |