| IED ID | IndEnz0002002847 |
| Enzyme Type ID | protease002847 |
| Protein Name |
Cystatin-8 Cystatin-related epididymal spermatogenic protein Cystatin-related epididymal-specific protein |
| Gene Name | Cst8 Cres |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAKPLWLSLILFIIPVALAVGVDQSKNEVKAQNYFGSINISNANVKQCVWFAMKEYNKESEDKYVFLVDKILHAKLQITDRMEYQIDVQISRSNCKKPLNNTENCIPQKKPELEKKMSCSFLVGALPWNGEFNLLSKECKDV |
| Enzyme Length | 142 |
| Uniprot Accession Number | P32766 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Performs a specialized role during sperm development and maturation. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (2); Glycosylation (2); Helix (2); Motif (1); Sequence conflict (1); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: Testicular factors or hormones other than androgens present in the testicular fluid may be involved in the regulation of CRES gene expression. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6UIO; |
| Mapped Pubmed ID | 11217851; 12466851; 12644294; 17855342; 18391535; 18391548; 20811015; 21051588; 23269664; 32601205; 7619504; 9826679; |
| Motif | MOTIF 77..81; /note=Secondary area of contact; /evidence=ECO:0000255 |
| Gene Encoded By | |
| Mass | 16,288 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |