Detail Information for IndEnz0002002870
IED ID IndEnz0002002870
Enzyme Type ID protease002870
Protein Name Hemagglutinin
Cleaved into: Hemagglutinin HA1 chain
Fragment
Gene Name HA
Organism Influenza B virus (strain B/Panama/45/1990)
Taxonomic Lineage Viruses Riboviria Orthornavirae Negarnaviricota Polyploviricotina Insthoviricetes Articulavirales Orthomyxoviridae Betainfluenzavirus Influenza B virus Influenza B virus (strain B/Panama/45/1990)
Enzyme Sequence MKAIIVLLMVVTSNADRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSHFANLKGTKTRGKLCPNCLNCTDLDVALARPMCVGTTPSAKASILHEVRPVTSGCFPIMHDRTKIRQLPNLLRGYENIRLSTQNVINAERAPGGPYRLGTSGSCPNVTSRDGFFATMAWAVPRDNKTATNPLTVEVPYICTKGEDQITVWGFHSDNKTQMKNLYGDSNPQKFTSSANGVTTHYVSQIGGFPNQTEDGGLPQSGRIVVDYMVQKPGKTGTIVYQRGVLLPQKVWCASGRSKVIKGSLPLIGEADCLHAKYGGLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKER
Enzyme Length 360
Uniprot Accession Number Q67375
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induce an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Glycosylation (8); Non-terminal residue (1); Signal peptide (1)
Keywords Disulfide bond;Fusion of virus membrane with host endosomal membrane;Fusion of virus membrane with host membrane;Glycoprotein;Hemagglutinin;Host cell membrane;Host membrane;Host-virus interaction;Lipoprotein;Membrane;Palmitate;Signal;Transmembrane;Viral attachment to host cell;Viral envelope protein;Viral penetration into host cytoplasm;Virion;Virus entry into host cell
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Virion membrane {ECO:0000305}; Single-pass type I membrane protein {ECO:0000305}. Host apical cell membrane; Single-pass type I membrane protein. Note=Targeted to the apical plasma membrane in epithelial polarized cells through a signal present in the transmembrane domain. Associated with glycosphingolipid- and cholesterol-enriched detergent-resistant lipid rafts.
Modified Residue
Post Translational Modification PTM: In natural infection, inactive HA is matured into HA1 and HA2 outside the cell by one or more trypsin-like, arginine-specific endoprotease secreted by the bronchial epithelial cells. One identified protease that may be involved in this process is secreted in lungs by Clara cells (By similarity). {ECO:0000250}.; PTM: Palmitoylated. {ECO:0000250}.
Signal Peptide SIGNAL 1..15; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 38,968
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda