| IED ID | IndEnz0002002969 |
| Enzyme Type ID | protease002969 |
| Protein Name |
Trypsin/factor XIIA inhibitor CHFI Hageman factor inhibitor |
| Gene Name | |
| Organism | Zea mays (Maize) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae PACMAD clade Panicoideae Andropogonodae Andropogoneae Tripsacinae Zea Zea mays (Maize) |
| Enzyme Sequence | MASSSSSSHRRLILAAAVLLSVLAAASASAGTSCVPGWAIPHNPLPSCRWYVTSRTCGIGPRLPWPELKRRCCRELADIPAYCRCTALSILMDGAIPPGPDAQLEGRLEDLPGCPREVQRGFAATLVTEAECNLATISGVAECPWILGGGTMPSK |
| Enzyme Length | 155 |
| Uniprot Accession Number | P01088 |
| Absorption | |
| Active Site | ACT_SITE 62; /evidence=ECO:0000269|PubMed:6610678 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent inhibitor of mammalian trypsin and a specific inhibitor of factor XIIa (activated hageman factor). |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (2); Chain (1); Disulfide bond (5); Helix (5); Natural variant (1); Propeptide (1); Sequence conflict (7); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000269|PubMed:6610678 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1BEA; 1BFA; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,302 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |