| IED ID | IndEnz0002003036 |
| Enzyme Type ID | protease003036 |
| Protein Name |
Preflagellin peptidase PFP EC 3.4.23.52 |
| Gene Name | flaK MJ0902 |
| Organism | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) |
| Taxonomic Lineage | cellular organisms Archaea Euryarchaeota Methanomada group Methanococci Methanococcales Methanocaldococcaceae Methanocaldococcus Methanocaldococcus jannaschii Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) |
| Enzyme Sequence | MINFIVGAIGLLIASIYDLKSREIEDYVWVSMVIFGLIYNGYLSFISHDMLYVIQSIVGFIVCFFLGFFMFLLGVGGGDGKLIMGLGALIPKYNMPIHTPLGAILNYLYLPSFPIMVVINAMFFSITLPIIIFLRNVIRGVKPKTKKEVLCMFLGEKMKVSEAIKKERLILGNHENLKLLPSAEKDCDFSKFDKNEEIWVTPAIPFVVPIFLSYLLTSIIGDKIIGIFLSVFGL |
| Enzyme Length | 234 |
| Uniprot Accession Number | Q58312 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleaves the signal peptide of 3 to 12 amino acids from the N-terminal of preflagellin, usually at Arg-Gly-|- or Lys-Gly-|-, to release flagellin.; EC=3.4.23.52; |
| DNA Binding | |
| EC Number | 3.4.23.52 |
| Enzyme Function | FUNCTION: Cleaves the N-terminal leader peptide from preflagellins. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1); Site (2); Topological domain (7); Transmembrane (6) |
| Keywords | Archaeal flagellum biogenesis;Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,294 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |