| IED ID | IndEnz0002003037 |
| Enzyme Type ID | protease003037 |
| Protein Name |
Preflagellin peptidase PFP EC 3.4.23.52 |
| Gene Name | flaK |
| Organism | Methanococcus voltae |
| Taxonomic Lineage | cellular organisms Archaea Euryarchaeota Methanomada group Methanococci Methanococcales Methanococcaceae Methanococcus Methanococcus voltae |
| Enzyme Sequence | MIAYAIGLLGLLIASIQDIKSREIENYIWIGMAVIGLLLSTYLSFTTGNFMPIISSISGFIICFIIGYLMFVLGIGGADGKILMGMGALIPSYAFPVYSSLQPLYTMEYIPWFPLLVFFNGVILMIVLPIYLFFKNLSNGVKPKKLKEYVLMLVGEYITVAEAKKGNKVVLGKGKDVKLIPSVNDDKNYDLSKYKDTQYVWATPELPLLVPIALSYIITPFLGDKILSIILPM |
| Enzyme Length | 233 |
| Uniprot Accession Number | Q8NKW5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleaves the signal peptide of 3 to 12 amino acids from the N-terminal of preflagellin, usually at Arg-Gly-|- or Lys-Gly-|-, to release flagellin.; EC=3.4.23.52; Evidence={ECO:0000269|PubMed:10633127, ECO:0000269|PubMed:14622420}; |
| DNA Binding | |
| EC Number | 3.4.23.52 |
| Enzyme Function | FUNCTION: Cleaves the N-terminal leader peptide from preflagellins. The processing of preflagellins is necessary for assembly of flagellins into a flagellum structure. {ECO:0000269|PubMed:10633127, ECO:0000269|PubMed:14622420}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 37 degrees Celsius. {ECO:0000269|PubMed:10633127}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.5. {ECO:0000269|PubMed:10633127}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Mutagenesis (6); Site (2); Topological domain (7); Transmembrane (6) |
| Keywords | Archaeal flagellum biogenesis;Cell membrane;Hydrolase;Membrane;Protease;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:10633127}; Multi-pass membrane protein {ECO:0000269|PubMed:10633127}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,888 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.23.52; |