| IED ID | IndEnz0002003117 |
| Enzyme Type ID | protease003117 |
| Protein Name |
Protein FsrB AgrBfs |
| Gene Name | fsrB EF_1821 |
| Organism | Enterococcus faecalis (strain ATCC 700802 / V583) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Lactobacillales Enterococcaceae Enterococcus Enterococcus faecalis (Streptococcus faecalis) Enterococcus faecalis (strain ATCC 700802 / V583) |
| Enzyme Sequence | MLIDWILKNIMDMDQEDQSGKTQWTKYYLTVYFSGLFNLLMILILSVLFGTLSETFIVYVVLIFLRPVAGGWHAKTKWLCRLESIVIYVAIPFVLKNSSVSLPFIYKILLMCLLVVLFYWYAPQGTAIEPVQPSDLNVLKKQSLIRVCLLILCSLFVKEKIASVILYGLVIQGLMILPVTKNLIEGSVFMKFGKKIIKNVIEKRVAKVSDGVGTKPRLNQNSPNIFGQWMGQTEKPKKNIEK |
| Enzyme Length | 242 |
| Uniprot Accession Number | P0DH69 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May be involved in the proteolytic processing of a quorum sensing system signal molecule precursor required for the regulation of the virulence genes for gelatinase (gelE) and a serine protease (sprE). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (5) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Quorum sensing;Reference proteome;Transmembrane;Transmembrane helix;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,613 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |