| IED ID | IndEnz0002003119 |
| Enzyme Type ID | protease003119 |
| Protein Name |
HTH-type transcriptional regulator Hpr Protease production regulatory protein Hpr |
| Gene Name | hpr BH1185 |
| Organism | Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Alkalihalobacillus Alkalihalobacillus halodurans (Bacillus halodurans) Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans) |
| Enzyme Sequence | MEQQTAYSLKQSIIFSHKFAQLSKALWKSVEKDWQTWIKPFNLNINEHHILWITYHLDGASISDIAKFGVMHVSTAFNFSKKLEERGLLTFSKREHDKRNTYVDLTEQGRELFLETLEAYKPSTYSVYGGALPIKDLYGKFPEFSELLSIVRHVYGPDFIDMFETALTRLEDGFIEEDGKLKAVDSETKSTV |
| Enzyme Length | 192 |
| Uniprot Accession Number | Q9KDM7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 62..85; /note=H-T-H motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01911 |
| EC Number | |
| Enzyme Function | FUNCTION: Negative regulator of protease production and sporulation. {ECO:0000255|HAMAP-Rule:MF_01911}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Domain (1) |
| Keywords | DNA-binding;Reference proteome;Repressor;Sporulation;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,239 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |