| IED ID | IndEnz0002003155 |
| Enzyme Type ID | protease003155 |
| Protein Name |
Mitochondrial inner membrane protease subunit 1 EC 3.4.21.- |
| Gene Name | IMP1 PET2858 YMR150C YM9375.20C |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MTVGTLPIWSKTFSYAIRSLCFLHIIHMYAYEFTETRGESMLPTLSATNDYVHVLKNFQNGRGIKMGDCIVALKPTDPNHRICKRVTGMPGDLVLVDPSTIVNYVGDVLVDEERFGTYIKVPEGHVWVTGDNLSHSLDSRTYNALPMGLIMGKIVAANNFDKPFWDGSIRNIWGFKWINNTFLDVQAKSN |
| Enzyme Length | 190 |
| Uniprot Accession Number | P28627 |
| Absorption | |
| Active Site | ACT_SITE 40; /evidence=ECO:0000250; ACT_SITE 84; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Catalytic component of the mitochondrial inner membrane peptidase (IMP) complex. IMP catalyzes the removal of signal peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. The two catalytic IMP subunits seem to have non-overlapping substrate specificities. IMP1 substrates include nuclear encoded CYB2, mitochondrially encoded COX2, NADH-cytochrome b5 reductase and GUT2. {ECO:0000269|PubMed:15118906}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Initiator methionine (1); Mutagenesis (8); Sequence conflict (1) |
| Keywords | Direct protein sequencing;Hydrolase;Membrane;Mitochondrion;Mitochondrion inner membrane;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10821182; 10906275; 11943460; 11996120; 12191769; 15254042; 15905047; 16450175; 1991446; 20124346; 21958598; 22172993; 23276920; 23994494; 24287567; 25959673; 27226123; 27550809; 3015596; 6313350; 7510017; 7586024; 8266095; 8879245; 8988248; 9604886; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,433 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |