| IED ID | IndEnz0002003197 |
| Enzyme Type ID | protease003197 |
| Protein Name |
Gag polyprotein Cleaved into: Matrix protein p16; Capsid protein p25; Nucleocapsid protein p14 |
| Gene Name | gag |
| Organism | Maedi visna virus (strain KV1772) (MVV) (Visna lentivirus) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Lentivirus Visna-maedi virus Maedi visna virus (strain KV1772) (MVV) (Visna lentivirus) |
| Enzyme Sequence | MAKQGSKEKKGYPELKEVIKATCKIRVGPGKETLTEGNCLWALKTIDFIFEDLKTEPWTITKMYTVWDRLKGLTPEETSKREFASLQATLACIMCSQMGMKPETVQAAKGIISMKEGLHENKEAKGEKVEQLYPNLEKHREVYPIVNLQAGGRSWKAVESVVFQQLQTVAMQHGLVSEDFERQLAYYATTWTSKDILEVLAMMPGNRAQKELIQGKLNEEAERWVRQNPPGPNVLTVDQIMGVGQTNQQASQANMDQARQICLQWVITALRSVRHMSHRPGNPMLVKQKNTESYEDFIARLLEAIDAEPVTDPIKTYLKVTLSYTNASTDCQKQMDRTLGTRVQQATVEEKMQACRDVGSEGFKMQLLAQALRPQGKAGQKGVNQKCYNCGKPGHLARQCRQGIICHHCGKRGHMQKDCRQKKQQGNNRRGPRVVPSAPPML |
| Enzyme Length | 442 |
| Uniprot Accession Number | P35955 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Isoform Gag polyprotein]: Mediates, with Gag-Pol polyprotein, the essential events in virion assembly, including binding the plasma membrane, making the protein-protein interactions necessary to create spherical particles, recruiting the viral Env proteins, and packaging the genomic RNA via direct interactions with the RNA packaging sequence. {ECO:0000250|UniProtKB:P04585}.; FUNCTION: [Matrix protein p16]: Targets the polyprotein to the plasma membrane. {ECO:0000250|UniProtKB:P12497}.; FUNCTION: [Capsid protein p25]: Forms the core that encapsulates the genomic RNA-nucleocapsid complex in the virion. {ECO:0000250|UniProtKB:P04585}.; FUNCTION: [Nucleocapsid protein p14]: Encapsulates and protects viral dimeric unspliced genomic RNA (gRNA). Binds these RNAs through its zinc fingers. Acts as a nucleic acid chaperone which is involved in rearrangement of nucleic acid secondary structure during gRNA retrotranscription. Also facilitates template switch leading to recombination. {ECO:0000250|UniProtKB:P04585}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Motif (1); Region (1); Site (1); Zinc finger (2) |
| Keywords | Capsid protein;Host-virus interaction;Metal-binding;Repeat;Ribosomal frameshifting;Viral budding;Viral budding via the host ESCRT complexes;Viral release from host cell;Virion;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Matrix protein p16]: Virion {ECO:0000305}.; SUBCELLULAR LOCATION: [Capsid protein p25]: Virion {ECO:0000305}.; SUBCELLULAR LOCATION: [Nucleocapsid protein p14]: Virion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: [Isoform Gag polyprotein]: Specific enzymatic cleavages by the viral protease yield mature proteins. {ECO:0000305}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 436..439; /note=PTAP/PSAP motif |
| Gene Encoded By | |
| Mass | 49,857 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |