| IED ID | IndEnz0002003209 |
| Enzyme Type ID | protease003209 |
| Protein Name |
Heavy metal-associated isoprenylated plant protein 27 AtHIP27 AtHIPP27 |
| Gene Name | HIPP27 At5g66110 K2A18.19 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGFRDICYRKHHKKLKQFQKVEIKVKMDCEGCERRVRKSVEGMKGVSKVTVDPKQSKLTVEGFVQPSKVVHRVMHRTGKKAELWPYVPYEVVPHPYAPGAYDKKAPPGYVRNALADPLVAPLARASSFEVKYTSAFSDDNPNACTIM |
| Enzyme Length | 147 |
| Uniprot Accession Number | Q67ZW1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Heavy-metal-binding protein. Binds cadmium. May be involved in cadmium transport and play a role in cadmium detoxification. {ECO:0000250|UniProtKB:Q9C9A3}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous gene model prediction (1); Lipidation (1); Metal binding (2); Modified residue (1); Propeptide (1) |
| Keywords | Cadmium;Lipoprotein;Membrane;Metal-binding;Methylation;Prenylation;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000250|UniProtKB:Q9SZN7}. |
| Modified Residue | MOD_RES 144; /note=Cysteine methyl ester; /evidence=ECO:0000250|UniProtKB:Q9SZN7 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12196180; 15047901; 17644812; 18631293; 22645532; 29470862; 32457808; |
| Motif | |
| Gene Encoded By | |
| Mass | 16,651 |
| Kinetics | |
| Metal Binding | METAL 29; /evidence=ECO:0000255|PROSITE-ProRule:PRU00280; METAL 32; /evidence=ECO:0000255|PROSITE-ProRule:PRU00280 |
| Rhea ID | |
| Cross Reference Brenda |