| IED ID | IndEnz0002003268 |
| Enzyme Type ID | protease003268 |
| Protein Name |
Proteinase inhibitor type-2 Proteinase inhibitor type II |
| Gene Name | |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MAVHKVSFVAHLLVLGMFLLLVDAKACTKECGNFAYGICPRSQGTPDDPICTTCCAGYKGCNYYSANGTFICEGSSDPKNPNVCPQFCDPDIAYSKCPRSEGETIINPTGCTTCCTGYKGCYYFGQDGEFVCEGESDEPKSCTTECDPRVATISCPFSGLVKINQECINCCNADKGCELYDNDGSLICTGGEPQSAA |
| Enzyme Length | 197 |
| Uniprot Accession Number | Q40561 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8); Repeat (3); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Repeat;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | INDUCTION: Locally induced in leaves subjected to different types of stress (TMV infection, wounding, UV irradiation). |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,985 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |