| IED ID | IndEnz0002003272 |
| Enzyme Type ID | protease003272 |
| Protein Name |
Radiation response metalloprotease IrrE EC 3.4.24.- DNA repair regulatory protein IrrE |
| Gene Name | irrE Deide_03030 |
| Organism | Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Deinococcus-Thermus Deinococci Deinococcales Deinococcaceae Deinococcus Deinococcus deserti Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115) |
| Enzyme Sequence | MTDPAPPPTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRQEDEGEGGGAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALPAGRSEPDADKPEAPGDQS |
| Enzyme Length | 281 |
| Uniprot Accession Number | C1CZ84 |
| Absorption | |
| Active Site | ACT_SITE 83; /evidence="ECO:0000305|PubMed:19150362, ECO:0000305|PubMed:25170972" |
| Activity Regulation | ACTIVITY REGULATION: Protease activity is inhibited by EDTA. {ECO:0000269|PubMed:25170972}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Plays a central regulatory role in DNA repair and protection pathways in response to radiation stress. Acts as a site-specific metalloprotease that cleaves and inactivates the repressor proteins DdrOC and DdrOP3, resulting in induced expression of genes required for DNA repair and cell survival after exposure to radiation. {ECO:0000269|PubMed:25170972}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (9); Chain (1); Helix (9); Metal binding (3); Mutagenesis (7); Region (1); Turn (1) |
| Keywords | 3D-structure;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Stress response;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 3DTE; 3DTI; 3DTK; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,029 |
| Kinetics | |
| Metal Binding | METAL 82; /note=Zinc; catalytic; /evidence=ECO:0000269|PubMed:19150362; METAL 86; /note=Zinc; catalytic; /evidence=ECO:0000269|PubMed:19150362; METAL 113; /note=Zinc; catalytic; /evidence=ECO:0000269|PubMed:19150362 |
| Rhea ID | |
| Cross Reference Brenda |