| IED ID | IndEnz0002003281 |
| Enzyme Type ID | protease003281 |
| Protein Name |
Cyclic AMP-responsive element-binding protein 3 CREB-3 cAMP-responsive element-binding protein 3 Luman Cleaved into: Processed cyclic AMP-responsive element-binding protein 3 |
| Gene Name | CREB3 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MSHMELALDPGDHDLLGFLLEESGGLGAAPDEALTSPPDWELPLSESLSDWDVEDFLSCLPSPPAVLNVFSNSDPCLVQHDHTYSLSQEHVSIDLDNESYEKERAQMTPLRVEEPADQEIARLILTEEEKRLLEKEGLTLPGMLPLTKMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGGLESRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAMVIQTANKASSSSTCVLVLLFSFCLLLVPAMYSSDTRGSLPAEHRVLSRQLRALPSEDPPQLEPPALQSEVPKDSLNPELQAASNSCCLFHLMPQAPRAEPPLQLPLPDGFSGCSCPDSISPLHANLTREEGWLPTPSPTSVILQGRYSG |
| Enzyme Length | 368 |
| Uniprot Accession Number | Q8SQ19 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription. Plays a role in the unfolded protein response (UPR), promoting cell survival versus ER stress-induced apoptotic cell death. Also involved in cell proliferation, migration and differentiation, tumor suppression and inflammatory gene expression. Acts as a positive regulator of LKN-1/CCL15-induced chemotaxis signaling of leukocyte cell migration. Associates with chromatin to the HERPUD1 promoter. Also induces transcriptional activation of chemokine receptors. Functions as a negative transcriptional regulator in ligand-induced transcriptional activation of the glucocorticoid receptor NR3C1 by recruiting and activating histone deacetylases (HDAC1, HDAC2 and HDAC6). Also decreases the acetylation level of histone H4. Does not promote the chemotactic activity of leukocyte cells. {ECO:0000250|UniProtKB:O43889}.; FUNCTION: [Processed cyclic AMP-responsive element-binding protein 3]: This is the transcriptionally active form that translocates to the nucleus and activates unfolded protein response (UPR) target genes during endoplasmic reticulum (ER) stress response. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3') and C/EBP sequences present in many promoters to activate transcription of the genes. Binds to the unfolded protein response element (UPRE) consensus sequences sites. Binds DNA to the 5'-CCAC[GA]-3'half of ERSE II (5'-ATTGG-N-CCACG-3'). {ECO:0000250|UniProtKB:O43889}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Domain (1); Glycosylation (1); Motif (3); Region (3); Sequence conflict (1); Site (2); Topological domain (2); Transmembrane (1) |
| Keywords | Activator;Chemotaxis;Cytoplasm;DNA-binding;Endoplasmic reticulum;Glycoprotein;Golgi apparatus;Membrane;Nucleus;Reference proteome;Repressor;Signal-anchor;Transcription;Transcription regulation;Transmembrane;Transmembrane helix;Unfolded protein response |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:O43889}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:O43889, ECO:0000255}. Golgi apparatus {ECO:0000250|UniProtKB:O43889}. Nucleus {ECO:0000250|UniProtKB:O43889}. Cytoplasm {ECO:0000250|UniProtKB:O43889}. Note=Colocalizes with HCFC1 in neuronal cell bodies of the trigeminal ganglia. Colocalizes with DCSTAMP in the ER membrane of immature dendritic cell (DC). Colocalizes with CANX, CCR1, HCFC1 in the ER membrane. {ECO:0000250|UniProtKB:O43889}.; SUBCELLULAR LOCATION: [Processed cyclic AMP-responsive element-binding protein 3]: Nucleus {ECO:0000250|UniProtKB:O43889}. Note=Upon RIP activation the transcriptional active processed cyclic AMP-responsive element-binding protein 3 form translocates into the nucleus. Detected in the nucleus upon dendritic cell maturation and RIP activation. Colocalizes with CREBRF in nuclear foci. Colocalizes with CREBZF in promyelocytic leukemia protein nuclear bodies (PML-NB). {ECO:0000250|UniProtKB:O43889}. |
| Modified Residue | |
| Post Translational Modification | PTM: First proteolytically cleaved by site-1 protease (S1P) that generates membrane-associated N-terminus and a luminal C-terminus forms. The membrane-associated N-terminus form is further proteolytically processed probably by the site-2 protease (S2P) through a regulated intramembrane proteolysis (RIP), releasing the transcriptional active processed cyclic AMP-responsive element-binding protein 3 form, which is transported to the nucleus. The proteolytic cleavage is strongly induced during dendritic cell (DC) maturation and inhibited by DCSTAMP. That form is rapidly degraded. {ECO:0000250|UniProtKB:O43889}.; PTM: N-glycosylated. {ECO:0000250|UniProtKB:O43889}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 16..20; /note=LXXLL motif 1; MOTIF 57..61; /note=LXXLL motif 2; MOTIF 81..84; /note=HCFC1-binding-motif (HBM) |
| Gene Encoded By | |
| Mass | 40,912 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |