| IED ID | IndEnz0002003285 |
| Enzyme Type ID | protease003285 |
| Protein Name |
Cysteine proteinase inhibitor Cystatin Hv-CPI |
| Gene Name | ICY CPI |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | MAEAAHGGGLRGRGVLLGGVQDAPAGRENDLETIELARFAVAEHNAKANALLEFEKLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAWENFKQLQEFKPAA |
| Enzyme Length | 107 |
| Uniprot Accession Number | Q9LEI7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits papain, ficin, cathepsin B and, to a lesser extent, chymopapain, but is inactive against bromelain. Inhibits the growth of pathogenic fungi. Regulated by the DOF transcription factors SAD (activator) and BPBF (repressor). {ECO:0000269|PubMed:11414618, ECO:0000269|PubMed:14558689}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Motif (1); Mutagenesis (4); Sequence conflict (2); Site (1) |
| Keywords | Plant defense;Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: Up-regulated by dark and cold shock, anaerobiosis and upon seed imbibition. Repressed by gibberellic acid treatment in aleurones, but not in leaves. Not affected by abscisic acid treatment. {ECO:0000269|PubMed:11414618, ECO:0000269|PubMed:12598566, ECO:0000269|PubMed:15611149}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 63..67; /note=Secondary area of contact; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 11,781 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |