| IED ID | IndEnz0002003291 |
| Enzyme Type ID | protease003291 |
| Protein Name |
Envelope glycoprotein Env polyprotein Cleaved into: Surface protein SU Glycoprotein 70 gp70 Fragment |
| Gene Name | env |
| Organism | Feline leukemia virus (isolate CFE-16) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Gammaretrovirus Feline leukemia virus Feline leukemia virus (isolate CFE-16) |
| Enzyme Sequence | MEGPTHPKPSKDKTFSWDLIILVGVLLRLDVGMANPSPHQVYNITWTITNLVTGTKANATSMLGTLTDAFPTLYFDLCDIIGNTWNPSGQEPFPGYGCDQPMRRWQQRNTAFYVCPGHANRKQCGGPQDGFCAVWGCETTGETYWKPTSSWDYITVKKGVTQGIYQCSGGGWCGPCYDKAVHSSTTGASEGGRCNPLILQFTQKGRQTSWDGPKSWGLRLYRSGYDPIALFSVSRQVMTITPPQAMGPDPVLPDQKPPSRTVSPQLNVIPHPS |
| Enzyme Length | 273 |
| Uniprot Accession Number | P21444 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: The surface protein (SU) attaches the virus to the host cell by binding to its receptor. This interaction triggers the refolding of the transmembrane protein (TM) and is thought to activate its fusogenic potential by unmasking its fusion peptide. Fusion occurs at the host cell plasma membrane (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Compositional bias (1); Disulfide bond (2); Glycosylation (2); Non-terminal residue (1); Region (1); Signal peptide (1); Topological domain (1) |
| Keywords | Disulfide bond;Fusion of virus membrane with host cell membrane;Fusion of virus membrane with host membrane;Glycoprotein;Host cell membrane;Host membrane;Host-virus interaction;Membrane;Signal;Viral attachment to host cell;Viral envelope protein;Viral penetration into host cytoplasm;Virion;Virus entry into host cell |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Surface protein]: Virion membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein. Note=The surface protein is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Specific enzymatic cleavages in vivo yield mature proteins. Envelope glycoproteins are synthesized as an inactive precursor that is N-glycosylated and processed likely by host cell furin or by a furin-like protease in the Golgi to yield the mature SU and TM proteins (By similarity). {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..34; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,008 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |