| IED ID |
IndEnz0002003364 |
| Enzyme Type ID |
protease003364 |
| Protein Name |
Proteinase inhibitor PSKP-2
|
| Gene Name |
|
| Organism |
Phyllomedusa sauvagei (Sauvage's leaf frog) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Metazoa
Eumetazoa
Bilateria
Deuterostomia
Chordata
Craniata
Vertebrata
Gnathostomata (jawed vertebrates)
Teleostomi
Euteleostomi
Sarcopterygii
Dipnotetrapodomorpha
Tetrapoda
Amphibia
Batrachia
Anura
Neobatrachia
Hyloidea
Hylidae (tree frogs)
Phyllomedusinae
Phyllomedusa (leaf frogs)
Phyllomedusa sauvagei (Sauvage's leaf frog)
|
| Enzyme Sequence |
VIEPDCKKYEGKKCPPDIALVCGTNGREYYNECALCVFIRDSTLKADKAIKIKKWGKC |
| Enzyme Length |
58 |
| Uniprot Accession Number |
P83579 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: May have a role in mucosal defense against microbes by interacting directly with their membranes. {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (3); Domain (1); Sequence uncertainty (1) |
| Keywords |
Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15153102}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
6,555 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|