Detail Information for IndEnz0002003382
IED ID IndEnz0002003382
Enzyme Type ID protease003382
Protein Name Adenosine 5'-monophosphoramidase HINT1
EC 3.9.1.-
Desumoylating isopeptidase HINT1
EC 3.4.22.-
Histidine triad nucleotide-binding protein 1
P13.7
Gene Name HINT1 HINT
Organism Oryctolagus cuniculus (Rabbit)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Lagomorpha Leporidae (rabbits and hares) Oryctolagus Oryctolagus cuniculus (Rabbit)
Enzyme Sequence MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
Enzyme Length 126
Uniprot Accession Number P80912
Absorption
Active Site ACT_SITE 112; /note=Tele-AMP-histidine intermediate; /evidence=ECO:0000250|UniProtKB:P49773
Activity Regulation
Binding Site BINDING 99; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=adenosine 5'-phosphoramidate + H2O = AMP + NH4(+); Xref=Rhea:RHEA:67916, ChEBI:CHEBI:15377, ChEBI:CHEBI:28938, ChEBI:CHEBI:57890, ChEBI:CHEBI:456215; Evidence={ECO:0000250|UniProtKB:P49773};
DNA Binding
EC Number 3.9.1.-; 3.4.22.-
Enzyme Function FUNCTION: Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed:11805111, PubMed:15703176). Hydrolyzes adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate) (PubMed:15703176). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase (PubMed:20940308). Hydrolyzes Met-AMP, His-AMP, Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester (By similarity). Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide (PubMed:20940308). In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1 (By similarity). Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity). Also exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RANGAP1 and RGS17 (By similarity). {ECO:0000250|UniProtKB:P49773, ECO:0000250|UniProtKB:P70349, ECO:0000269|PubMed:11805111, ECO:0000269|PubMed:15703176, ECO:0000269|PubMed:20940308}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding NP_BIND 43..44; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773; NP_BIND 105..107; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773; NP_BIND 112..114; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773
Features Active site (1); Beta strand (6); Binding site (1); Chain (1); Domain (1); Helix (5); Initiator methionine (1); Modified residue (5); Motif (1); Mutagenesis (4); Nucleotide binding (3)
Keywords 3D-structure;Acetylation;Apoptosis;Cytoplasm;Hydrolase;Nucleotide-binding;Nucleus;Phosphoprotein;Protease;Reference proteome;Thiol protease;Transcription;Transcription regulation;Ubl conjugation pathway
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P49773}. Nucleus {ECO:0000250|UniProtKB:P49773}.
Modified Residue MOD_RES 2; /note=N-acetylalanine; /evidence=ECO:0000250|UniProtKB:P62958; MOD_RES 21; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P49773; MOD_RES 30; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P49773; MOD_RES 45; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P70349; MOD_RES 72; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P70349
Post Translational Modification
Signal Peptide
Structure 3D X-ray crystallography (9)
Cross Reference PDB 1RZY; 3O1C; 3O1X; 3O1Z; 3QGZ; 3RHN; 4RHN; 5RHN; 6RHN;
Mapped Pubmed ID -
Motif MOTIF 110..114; /note=Histidine triad motif
Gene Encoded By
Mass 13,693
Kinetics
Metal Binding
Rhea ID RHEA:67916
Cross Reference Brenda