| IED ID | IndEnz0002003401 |
| Enzyme Type ID | protease003401 |
| Protein Name |
Leucine aminopeptidase 1 EC 3.4.11.- Leucyl aminopeptidase 1 LAP1 |
| Gene Name | LAP1 BDCG_07361 |
| Organism | Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Ajellomycetaceae Blastomyces Ajellomyces dermatitidis (Blastomyces dermatitidis) Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis) |
| Enzyme Sequence | MKFPSFLSLGIAASTTALAALPDQKPIGDTIADVHLGKFLIELAPGDTRWVTEEEKWGLKRDGRKFFDITAEVEQNLFPRAFAKTAVTFPTGLHRTVEVMPLAAQLSKDNMFSHLTTFTSFHTRYYKSETGIQSATWLMKQIQKTISSSPASNARVEKFEHPWGQFSVIATVPGQSNKTVVIGAHQDSINMFLPSILAAPGADDDGSGTVTILEAFRVLLQSEAIAQGNATNTVEFHWYSAEEGGLLGSQAVFSKYKQDNKDIRAMLQQDMTGYSKGTLDAGELESVGVITDFVDEGLTEFIKKVVNGYCDIPFVLTECGYACSDHASASRFGYPSAFVIESKFEHSSQHIHTGQDTIETLDFNHMLQHAKMTLGLAYELAFADI |
| Enzyme Length | 385 |
| Uniprot Accession Number | C5GRP9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.11.- |
| Enzyme Function | FUNCTION: Extracellular aminopeptidase that allows assimilation of proteinaceous substrates. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Glycosylation (2); Metal binding (6); Propeptide (1); Signal peptide (1) |
| Keywords | Aminopeptidase;Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Protease;Reference proteome;Secreted;Signal;Zinc;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 42,315 |
| Kinetics | |
| Metal Binding | METAL 185; /note=Zinc 1; /evidence=ECO:0000250; METAL 204; /note=Zinc 1; /evidence=ECO:0000250; METAL 204; /note=Zinc 2; catalytic; /evidence=ECO:0000250; METAL 243; /note=Zinc 2; catalytic; /evidence=ECO:0000250; METAL 270; /note=Zinc 1; /evidence=ECO:0000250; METAL 352; /note=Zinc 2; catalytic; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |