| IED ID | IndEnz0002003407 |
| Enzyme Type ID | protease003407 |
| Protein Name |
Late L2 mu core protein Protein X pX pMu |
| Gene Name | PX |
| Organism | Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human mastadenovirus F Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40) |
| Enzyme Sequence | MALTCRFRIPVPSYRGRSRRRRGMAGSGRRRALRRRIKGGFLPALIPIIAAAIGAIPGVASVALQAARKQ |
| Enzyme Length | 70 |
| Uniprot Accession Number | Q64858 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: The role of the precursor might be to condense the viral prochromatin for encapsidation by virtue of the two basic domains. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Peptide (1); Propeptide (2); Sequence conflict (1); Site (2) |
| Keywords | DNA-binding;Late protein;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,596 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |