| IED ID | IndEnz0002003452 |
| Enzyme Type ID | protease003452 |
| Protein Name |
Extracellular cysteine protease EC 3.4.22.- Staphopain |
| Gene Name | ecpA ecp |
| Organism | Staphylococcus epidermidis |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis |
| Enzyme Sequence | MYAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGRNTQYLNRMTSYNEVDQLTTNNQGIAVLGKRVESSDGIHAGHAMAVAGNAKVNNGQKVILIWNPWDNGLMTQDAHSNIIPVSNGDHYEWYASIYGY |
| Enzyme Length | 174 |
| Uniprot Accession Number | P0C0P9 |
| Absorption | |
| Active Site | ACT_SITE 24; /evidence=ECO:0000255|PROSITE-ProRule:PRU10089; ACT_SITE 120; /evidence=ECO:0000255|PROSITE-ProRule:PRU10089; ACT_SITE 141; /evidence=ECO:0000255|PROSITE-ProRule:PRU10089 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by heavy metal ions such as Zn(2+) or Ni(2+), iodoacetamide, N-ethylmaleimide, leupeptin, SDS and E-64. Also inhibited by chloromethylketones TPCK and TLCK and by human plasma inhibitor alpha-2-macroglobulin. Stimulated by L-cysteine. {ECO:0000269|PubMed:11767947}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Cysteine protease able to cleave elastin, insulin, myoglobin, fibronectin, fibrinogen, HMW-kininogen, alpha-1-protease inhibitor and alpha-1-antitrypsin. Along with other extracellular proteases may contribute to the colonization and infection of human tissues. {ECO:0000269|PubMed:11767947, ECO:0000269|PubMed:15255185}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0 for elastin hydrolysis.; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Cell wall;Direct protein sequencing;Hydrolase;Protease;Secreted;Thiol protease;Virulence;Zymogen |
| Interact With | |
| Induction | INDUCTION: Expression occurs in a growth-phase-dependent manner with optimal expression at post-exponential phase. {ECO:0000269|PubMed:15255185}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000269|PubMed:15255185}. Secreted {ECO:0000269|PubMed:15255185}. |
| Modified Residue | |
| Post Translational Modification | PTM: Proteolytically cleaved. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,832 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |