| IED ID | IndEnz0002003455 |
| Enzyme Type ID | protease003455 |
| Protein Name |
Cystatin 10 Carminerin |
| Gene Name | Cst10 DD72 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MASLLSPSMPVLAAVALTLTLAVIPEASTNAEAKQVVLGGVEPADPKDKEVQKVVKFAVRTYNDMDNDLYLSKPIRLMSASQQVVAGKNYYLKIELGRTTCTKTESNLVDCPFNEQPDQQKRVICNFQINVAPWLNKMSMTNFNCYNF |
| Enzyme Length | 148 |
| Uniprot Accession Number | Q9JM84 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May play a role in the last steps of the chondrocyte differentiation pathway as an inducer of maturation (PubMed:13679380). Induces chondrocyte calcification during endochondral ossification by playing a role in the transcriptional inhibition of ENPP1, a generator of pyrophosphate which inhibits calcification (PubMed:16680148). Possibly impairs the binding of a transcription factor to the ENPP1 promoter (PubMed:16680148). Unlike other cystatins, does not have thiol protease inhibitor activity (PubMed:16680148). {ECO:0000269|PubMed:13679380, ECO:0000269|PubMed:16680148}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Disulfide bond (2); Domain (1); Signal peptide (1) |
| Keywords | Alternative splicing;Biomineralization;Cytoplasm;Disulfide bond;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: By high phosphate diet. {ECO:0000269|PubMed:11856874, ECO:0000269|PubMed:13679380}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:13679380}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..33; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10713450; 18391548; |
| Motif | |
| Gene Encoded By | |
| Mass | 16,451 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |