| IED ID | IndEnz0002003468 |
| Enzyme Type ID | protease003468 |
| Protein Name |
COP9 signalosome complex subunit 5a Signalosome subunit 5a EC 3.4.-.- Jun activation domain-binding homolog 2 Fragments |
| Gene Name | CSN5A AJH2 |
| Organism | Brassica oleracea (Wild cabbage) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Brassiceae Brassica Brassica oleracea (Wild cabbage) |
| Enzyme Sequence | KNILTVEQPDSSSSDGIFYYDEASKRVQISALAL |
| Enzyme Length | 34 |
| Uniprot Accession Number | P68354 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. The CSN complex is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (1); Non-terminal residue (2) |
| Keywords | Cytoplasm;Developmental protein;Direct protein sequencing;Hydrolase;Metal-binding;Metalloprotease;Nucleus;Phytochrome signaling pathway;Protease;Signalosome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. Nucleus. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,746 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |