| IED ID | IndEnz0002003495 |
| Enzyme Type ID | protease003495 |
| Protein Name |
Cystatin-B Cystatin-beta Liver thiol proteinase inhibitor Stefin-B |
| Gene Name | Cstb Cst6 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MMCGAPSATMPATTETQEIADKVKSQLEEKANQKFDVFKAISFRRQVVAGTNFFIKVDVGEEKCVHLRVFEPLPHENKPLTLSSYQTDKEKHDELTYF |
| Enzyme Length | 98 |
| Uniprot Accession Number | P01041 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This is an intracellular thiol proteinase inhibitor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Motif (1); Site (1) |
| Keywords | Acetylation;Cytoplasm;Direct protein sequencing;Protease inhibitor;Reference proteome;Thiol protease inhibitor |
| Interact With | P00441 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000269|PubMed:6626228 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10792446; 1239805; 12901878; 24063889; 24234043; 30052474; |
| Motif | MOTIF 46..50; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 11,196 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |