IED ID | IndEnz0002003534 |
Enzyme Type ID | protease003534 |
Protein Name |
Ovomucoid Fragment |
Gene Name | |
Organism | Cyanochen cyanoptera (Blue-winged goose) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Anseriformes (ducks geese and swans) Anatidae (waterfowl) Tadorninae Cyanochen Cyanochen cyanoptera (Blue-winged goose) |
Enzyme Sequence | VATVDCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCNAVVDSNGTLTLSHFGEC |
Enzyme Length | 54 |
Uniprot Accession Number | P68152 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (3); Domain (1); Glycosylation (1); Non-terminal residue (2); Site (1) |
Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 5,758 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |