| IED ID | IndEnz0002003535 |
| Enzyme Type ID | protease003535 |
| Protein Name |
Cysteine protease IpaJ EC 3.4.22.- Effector protein IpaJ Invasion plasmid antigen J |
| Gene Name | ipaJ CP0122 pWR501_0130 |
| Organism | Shigella flexneri |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Shigella Shigella flexneri |
| Enzyme Sequence | MSEQRKPCKRGCIHTGVMLYGVLLQGAIPREYMISHQTDVRVNENRVNEQGCFLARKQMYDNSCGAASLLCAAKELGVDKIPQYKGSMSEMTRKSSLDLDNRCERDLYLITSGNYNPRIHKDNIADAGYSMPDKIVMATRLLGLNAYVVEESNIFSQVISFIYPDARDLLIGMGCNIVHQRDVLSSNQRVLEAVAVSFIGVPVGLHWVLCRPDGSYMDPAVGENYSCFSTMELGARRSNSNFIGYTKIGISIVITNEAL |
| Enzyme Length | 259 |
| Uniprot Accession Number | Q54150 |
| Absorption | |
| Active Site | ACT_SITE 64; /evidence=ECO:0000305|PubMed:23535599; ACT_SITE 206; /evidence=ECO:0000305|PubMed:23535599; ACT_SITE 218; /evidence=ECO:0000305|PubMed:23535599 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Virulence factor that eliminates N-myristoyl protein modifications in infected host cells. Acts as a cysteine protease that cleaves the peptide bond between N-myristoylated Gly-2 and Asn-3 of human ARF1, leading to the elimination of the myristoyl group and alteration of protein trafficking in host cell. Could also cleave an array of N-myristoylated host proteins involved in cellular growth, signal transduction, autophagasome maturation and organelle function. {ECO:0000269|PubMed:23535599}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Mutagenesis (3) |
| Keywords | Host cytoplasm;Hydrolase;Plasmid;Protease;Reference proteome;Secreted;Virulence |
| Interact With | |
| Induction | INDUCTION: Expression is temperature-independent. {ECO:0000269|PubMed:9441862}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:18208325}. Host cytoplasm {ECO:0000305|PubMed:18208325}. Note=Secreted via Mxi-Spa type III secretion system (TTSS), and delivered into the host cytoplasm. {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid pWR100; Plasmid pCP301; Plasmid pINV_F6_M1382 |
| Mass | 28,807 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |