| IED ID | IndEnz0002003536 |
| Enzyme Type ID | protease003536 |
| Protein Name |
Internal protein III IpIII |
| Gene Name | ipi3 |
| Organism | Enterobacteria phage T4 (Bacteriophage T4) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4) |
| Enzyme Sequence | MKTYQEFIAEASVVKAKGINKDEWTYRSGNGFDPKTAPIERYLATKASDFKAFAWEGLRWRTDLNIEVDGLKFAHIEDVVASNLDSEFVKADADLRRWNLKLFSKQKGPKFVPKAGKWVIDNKLAKAVNFAGLEFAKHKSSWKGLDAMAFRKEFADVMTKGGFKAEIDTSKGKFKDANIQYAYAVANAARGNS |
| Enzyme Length | 193 |
| Uniprot Accession Number | P13302 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Internal protein III is one of four proteins in a complex that functions in bacteriophage head maturation. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1); Site (1) |
| Keywords | Direct protein sequencing;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,687 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |