| IED ID | IndEnz0002003560 |
| Enzyme Type ID | protease003560 |
| Protein Name |
Exfoliative toxin A EC 3.4.21.- Epidermolytic toxin A |
| Gene Name | eta |
| Organism | Staphylococcus aureus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus |
| Enzyme Sequence | MNNSKIISKVLLSLSLFTVGASAFVIQDELMQKNHAKAEVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE |
| Enzyme Length | 280 |
| Uniprot Accession Number | P09331 |
| Absorption | |
| Active Site | ACT_SITE 110; /note=Charge relay system; ACT_SITE 158; /note=Charge relay system; ACT_SITE 233; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Has serine protease-like properties and binds to the skin protein profilaggrin. Cleaves substrates after acidic residues. Exfoliative toxins cause impetigous diseases commonly referred as staphylococcal scalded skin syndrome (SSSS). {ECO:0000269|PubMed:2117445, ECO:0000269|PubMed:2384148}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (13); Chain (1); Helix (12); Mutagenesis (1); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Calcium;Direct protein sequencing;Hydrolase;Protease;Serine protease;Signal;Toxin;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..38 |
| Structure 3D | X-ray crystallography (4) |
| Cross Reference PDB | 1AGJ; 1DUA; 1DUE; 1EXF; |
| Mapped Pubmed ID | 10752623; |
| Motif | |
| Gene Encoded By | |
| Mass | 31,077 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |