| IED ID | IndEnz0002003567 |
| Enzyme Type ID | protease003567 |
| Protein Name |
Extracellular protease inhibitor 10 Secreted effector EPI10 |
| Gene Name | EPI10 |
| Organism | Phytophthora infestans (Potato late blight agent) (Botrytis infestans) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora infestans (Potato late blight agent) (Botrytis infestans) |
| Enzyme Sequence | MKSAFTLSLALVAVTATISAAADDNCSFGCLDVYKPVCGSNGETYSNSCYLRLASCKSNNGITEAGDGECASTPASSATPSPVTSSTGSTSGTVGCPDMCLDVYDPVSDENGKEYSNQCYMEMAKCKGTGYDDNKRSGNPGISTLDAERKLAFAPGYQGPPCGDMLCPDNYAPVCGSDGETYPNECDLGITSCNHPEQNITMVGEGPCPSQEQQQQQQQQQQKL |
| Enzyme Length | 224 |
| Uniprot Accession Number | Q6PQG3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Secreted effector that interacts with and inhibits the pathogenesis-related P69B subtilisin-like serine protease of host tomato (PubMed:15980196). Inhibition of host proteases by a pathogen extracellular protease inhibitor forms a specific type of defense-counterdefense mechanism between plants and microbial pathogens (PubMed:15980196). {ECO:0000269|PubMed:15980196}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8); Domain (3); Glycosylation (2); Region (2); Signal peptide (1); Site (3) |
| Keywords | Disulfide bond;Glycoprotein;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal;Virulence |
| Interact With | |
| Induction | INDUCTION: Expressed in zoospores (PubMed:15096512). Expressed during host infection (PubMed:15980196). {ECO:0000269|PubMed:15096512, ECO:0000269|PubMed:15980196}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15980196}. Note=Localizes to host apoplast where it targets defense proteases for inhibition. {ECO:0000269|PubMed:15980196}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,481 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |