IED Industry Enzyme Database

Detail Information for IndEnz0002003578
IED ID IndEnz0002003578
Enzyme Type ID protease003578
Protein Name Insulin-2
Cleaved into: Insulin-2 B chain; Insulin-2 A chain
Gene Name Ins2 Ins-2
Organism Mus musculus (Mouse)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse)
Enzyme Sequence MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN
Enzyme Length 110
Uniprot Accession Number P01326
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Disulfide bond (3); Peptide (2); Propeptide (1); Signal peptide (1)
Keywords Carbohydrate metabolism;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Glucose metabolism;Hormone;Reference proteome;Secreted;Signal
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..24; /evidence=ECO:0000269|PubMed:5063718
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 10036981; 10049364; 10078553; 10079507; 10102687; 10471495; 10471502; 10567552; 10691133; 10725233; 10725249; 10769089; 10842072; 10851133; 10868931; 10903178; 10950922; 11044404; 11062007; 11063728; 11076772; 11076855; 11159375; 11217851; 11272179; 11371557; 11375348; 11430820; 11448939; 11577200; 11606464; 11668390; 11685688; 11748146; 11784060; 11834725; 11854314; 11854325; 11897712; 11912494; 11981430; 12049785; 12059784; 12101187; 12189445; 12297296; 12399441; 12410230; 12412008; 12466851; 12473685; 12475795; 12488434; 12540615; 12559489; 12630555; 12639991; 12666204; 12681500; 12702762; 12745665; 12805218; 12815626; 12917290; 12917627; 12921743; 12925730; 1303252; 1317321; 1346376; 1358794; 1371010; 14517990; 14561778; 1460423; 14610273; 14641329; 14651921; 14660441; 14673160; 14688305; 14702043; 14706695; 14729487; 14736742; 14970313; 15005713; 15012626; 15033933; 15124020; 15163367; 15178709; 15226261; 15277382; 15282315; 15282335; 15286800; 15297605; 15326315; 15467835; 15494444; 15525682; 15548585; 15550470; 15567729; 15587270; 15617768; 15680365; 15705807; 15718275; 15731364; 15734845; 15739225; 15788565; 15793245; 15823575; 15888377; 15889095; 15914643; 15930104; 15944193; 15972000; 15980866; 16000322; 16039605; 16118394; 16169491; 16186384; 16192304; 16246260; 16283623; 16289958; 16306355; 16330324; 16399505; 16401696; 16418487; 16423820; 16435884; 16443760; 16456855; 16498401; 16511571; 16518820; 16537919; 16542650; 16556734; 16580660; 16602821; 16604193; 16611688; 16612590; 16627579; 16750430; 16785498; 16799061; 16804066; 16847318; 16887115; 16894357; 16912273; 16920096; 16923392; 16936198; 16951258; 16954344; 16962573; 16964447; 16964608; 17001468; 1701096; 1702294; 17049510; 17065330; 17065333; 17082643; 17141632; 17151334; 17185046; 17192470; 17202186; 17222338; 17267606; 17303660; 17303807; 17334640; 17339028; 17355878; 17360442; 17360472; 17366624; 17400205; 17416457; 17418116; 17459508; 17533574; 17537793; 17585110; 17595213; 17596282; 17599412; 17600118; 17607359; 17647009; 17666471; 17693256; 17786244; 17804764; 17849440; 17855428; 17855560; 17911348; 17928203; 17936263; 17988662; 17996499; 18006238; 18039841; 18056790; 18058910; 18077505; 1811941; 18155690; 18184911; 18186922; 18192873; 18199433; 18219478; 18227155; 18245324; 18256360; 18286202; 18294628; 18297134; 18316032; 18421434; 18439911; 18443355; 18452912; 18460333; 18469181; 18471525; 18498355; 18506029; 18515593; 18519800; 18554416; 18558660; 18559662; 18560595; 18563383; 18591390; 18591393; 18599523; 18599526; 18635610; 18678617; 18715949; 18723011; 18772165; 18776938; 18778483; 18788099; 19022256; 19092805; 19111542; 19120291; 19126201; 19131512; 19141476; 19148298; 19213844; 19223466; 19293336; 19364508; 19423844; 19470681; 19487660; 19501159; 19502415; 19542200; 19542201; 19583950; 19619492; 19628478; 19635472; 19644667; 19680229; 19684026; 19723764; 19759004; 19766716; 19773578; 19778534; 19793886; 19801494; 19805515; 1981054; 19880509; 19882138; 19914171; 19934006; 19955657; 19966211; 20009088; 20025861; 20040487; 20042456; 20098959; 20130530; 20138042; 20148032; 20153322; 20170518; 20185815; 20308425; 20364088; 20377894; 20377917; 20413507; 20413509; 20440000; 20448145; 20478304; 20479236; 20501666; 20520806; 20530744; 20533404; 20534694; 20547975; 20558340; 20570944; 20606719; 20614471; 20622165; 20627083; 20627934; 20678473; 20724579; 20811050; 20811152; 20825366; 20829433; 20836991; 20857084; 20869363; 20947821; 20948967; 20955341; 21068007; 21081123; 21113154; 21139688; 21173230; 21193740; 21209947; 21212173; 21245338; 21258336; 21266327; 21266405; 21267068; 21270265; 21281624; 21287656; 21293061; 21305342; 21335550; 21343540; 21388963; 21429093; 21447785; 21467180; 21490060; 21551953; 21555558; 21555585; 21559376; 21576366; 21593201; 21606463; 21636301; 21641382; 21677281; 21677750; 21723250; 21750032; 21774670; 21786021; 2181401; 21817126; 21828183; 21828338; 21829703; 21840999; 21841312; 21852533; 21856296; 21857924; 21867776; 21872588; 21876171; 21880149; 21880831; 21888903; 21909240; 21911471; 21913313; 21926276; 21926540; 21926555; 21940783; 21947380; 21953612; 21963766; 21965615; 22013016; 22015457; 22065673; 22095234; 22114024; 22114719; 22120711; 22129529; 22178591; 22187431; 22205225; 22240097; 22297234; 22297487; 22297672; 22387028; 22406641; 22426149; 22427377; 22427566; 22434868; 22440813; 22442384; 22449801; 22461559; 22474255; 22496773; 22505190; 22509386; 22522616; 22529374; 22539496; 22547676; 22554507; 22566534; 22586581; 22610174; 22653270; 22664958; 22675211; 22745161; 22764048; 22842467; 22865702; 22874919; 22883233; 22886636; 22896043; 22915034; 22980982; 23006325; 23006330; 23019230; 23056534; 23071096; 23077100; 23093780; 23099119; 23139813; 23152292; 23175628; 23177622; 23186339; 23193182; 23204275; 23209676; 23217255; 23221078; 23228931; 23243209; 23251343; 23251699; 23260145; 23271347; 23274896; 23287790; 23307960; 23316230; 23349479; 23354125; 23382704; 23391566; 23404117; 23408910; 23410753; 23412636; 23416061; 23431054; 23449223; 23454691; 23471965; 23494546; 23531619; 23552863; 23603491; 23610061; 23649519; 23661372; 23663738; 23684747; 23722904; 23734074; 23747309; 23775071; 23775122; 23789962; 23798316; 23801577; 23820623; 23823474; 23825921; 23852538; 23852729; 23863477; 23884891; 23894189; 23903190; 23929935; 23940571; 23946427; 23951058; 23973805; 23977133; 23977269; 23996959; 24003152; 24009262; 24064341; 24114270; 24127484; 24129189; 24135141; 24163078; 24163148; 24166718; 24226524; 24236044; 24247978; 24248465; 2427930; 24324549; 24370601; 24385342; 24387268; 24395790; 24449844; 24452639; 24458356; 24463424; 24477974; 24487024; 24491571; 24574008; 24583012; 24677271; 24703908; 24721715; 24726366; 24740573; 24743240; 24812425; 24820416; 24840347; 24848070; 24848689; 24943217; 24966386; 25053427; 25063451; 25107471; 25126760; 25133424; 25176043; 25186293; 25187372; 25207540; 25233132; 25249504; 25274988; 25343275; 25367577; 25404734; 25428125; 25428948; 25500700; 25523391; 25536533; 25576928; 25613939; 25652387; 25652452; 25695968; 25715394; 25715395; 25784544; 25789863; 25801033; 25902541; 25912690; 25918232; 25944670; 25957229; 25985365; 25987249; 26015547; 26021489; 26029927; 26041444; 26075820; 2608062; 26122048; 26155745; 26156633; 26169832; 26203118; 26214584; 26232095; 26235979; 26251404; 26334030; 26340930; 26361146; 26378466; 26389675; 26395740; 26411367; 26450967; 26470785; 26494286; 26494792; 26518685; 26534984; 26552047; 26554594; 26595448; 26597883; 26626461; 26631740; 26683376; 26696124; 26747235; 26752640; 26771085; 26784909; 26830324; 26858454; 26887806; 26901059; 26944677; 26953160; 26956881; 26968895; 27052164; 27055260; 27130279; 27133129; 27145011; 27159053; 27206247; 27270601; 27283743; 27292642; 27297878; 27335233; 27340827; 27349930; 27382987; 27482904; 27495224; 27528615; 27572106; 27581061; 27585521; 27620487; 27656411; 27658750; 27706190; 27736991; 27740873; 27802520; 27813676; 27820699; 27855634; 27864307; 27892540; 27899487; 27936229; 27993987; 28017717; 28069641; 28071588; 28071719; 28100774; 28102311; 28118981; 28154187; 28193997; 28214591; 28248965; 28259677; 28322199; 28324005; 28424212; 28457793; 28490532; 28493939; 28535269; 28576773; 28580283; 28624504; 28630133; 28700945; 28705881; 28793255; 28837672; 28883608; 28893946; 28922976; 29029025; 29058721; 29061652; 29074590; 29079704; 29122848; 29133483; 29180572; 29203863; 29207116; 29211719; 29211853; 29231167; 29272356; 29304075; 29330353; 29348399; 29348593; 29371604; 29373286; 29420703; 29434227; 29434323; 29439088; 29507125; 29590218; 29632144; 29654303; 29675273; 29761600; 29851956; 29875100; 29891593; 29910119; 29913163; 29972779; 29975570; 29995913; 30019207; 30022165; 30065034; 30065074; 30135482; 30168649; 30207172; 30293775; 30305368; 30361701; 30412050; 30420428; 30425063; 30425286; 30463601; 30480744; 30487608; 30488085; 30498224; 30504829; 30532991; 30576241; 30590051; 30620636; 30620902; 30665571; 30733468; 30773020; 30796028; 30853440; 30862678; 30886059; 30899071; 30914477; 30978208; 31039005; 31040360; 31069235; 31091127; 31116975; 31160417; 31160421; 31166707; 31185088; 31186351; 31187215; 31201281; 31208980; 31217360; 31250581; 31311313; 31323030; 31345937; 31380462; 31412250; 31506549; 31509011; 31509750; 31519700; 31604927; 31610731; 31624141; 31682591; 31726870; 31806622; 31806625; 31836691; 31875961; 31882119; 31914588; 31923647; 31974143; 32005704; 32059775; 32060653; 32072744; 32165492; 32169892; 32198206; 32241676; 32245798; 32313051; 32321760; 32332156; 32332159; 32350257; 32375022; 32404350; 32439763; 32467243; 32546815; 32640216; 32644973; 32699230; 32708537; 32715748; 32726619; 32857951; 32913274; 32994272; 33028844; 33057429; 33060607; 33069809; 33485967; 33505018; 33527355; 33567267; 33606210; 33653874; 33658226; 33662611; 33667344; 33667544; 33810480; 33811703; 33852861; 33859429; 33872860; 33932339; 34071003; 34086738; 34267243; 34446743; 34487921; 34675883; 34680110; 7031649; 7493641; 7534338; 7544754; 7590978; 7600975; 7613026; 7663515; 7706460; 7729600; 7773285; 7822777; 7867492; 7901001; 7911222; 7935793; 8012378; 8012396; 8043949; 8075499; 8148038; 8393762; 8421685; 8549854; 8625795; 8625829; 8631275; 8681804; 8787762; 8835532; 8861960; 8863190; 8887328; 8938454; 8963443; 9039503; 9121556; 9133560; 9144203; 9166597; 9177785; 9224716; 9260520; 9291463; 9337391; 9368764; 9384608; 9441664; 9465295; 9467008; 9507006; 9584121; 9584186; 9593767; 9618174; 9689059; 9774514; 9851981; 9884331; 9914469; 9922458; 9988214;
Motif
Gene Encoded By
Mass 12,364
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda