| IED ID | IndEnz0002003588 |
| Enzyme Type ID | protease003588 |
| Protein Name |
Trypsin inhibitor 1 NSTI-I Trypsin inhibitor I |
| Gene Name | |
| Organism | Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana sylvestris (Wood tobacco) (South American tobacco) |
| Enzyme Sequence | MVKLALVVIFLLLASLFQPLTAQSSCPGNKKETWPELIGVPAKFAREIIQKENSKLTNVPSVLNGSPVTKDFRCERVRLFVNVLDFVVQIPRVG |
| Enzyme Length | 94 |
| Uniprot Accession Number | Q02214 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Stress response. Inhibits trypsin. May play a role in the reentering of protoplasts into the cell cycle. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal;Vacuole |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000305}. Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,464 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |