| IED ID | IndEnz0002003605 |
| Enzyme Type ID | protease003605 |
| Protein Name |
Hirudin variant-2 Fragment |
| Gene Name | |
| Organism | Hirudo medicinalis (Medicinal leech) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Hirudinida Hirudiniformes Hirudinidae Hirudo Hirudo medicinalis (Medicinal leech) |
| Enzyme Sequence | AICVSQAITYTDCTESGQNLCLCEGSNVCGKGNKCILGSNGKGNQCVTGEGTPNPESHNNGDFEEIPEEYLQ |
| Enzyme Length | 72 |
| Uniprot Accession Number | P09945 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (3); Glycosylation (1); Helix (1); Modified residue (1); Non-terminal residue (1); Region (3); Signal peptide (1) |
| Keywords | 3D-structure;Disulfide bond;Glycoprotein;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Sulfation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 70; /note=Sulfotyrosine; /evidence=ECO:0000269|PubMed:3513162 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL <1..7 |
| Structure 3D | X-ray crystallography (112) |
| Cross Reference PDB | 1A2C; 1A46; 1A4W; 1A5G; 1A61; 1B5G; 1DOJ; 1K21; 1K22; 1NRS; 1TMB; 1TMU; 1VZQ; 1W7G; 1WAY; 2BVR; 2BVS; 2BVX; 2BXT; 2BXU; 2C8W; 2C8X; 2C8Y; 2C8Z; 2C90; 2C93; 2R2M; 2ZFQ; 2ZFR; 2ZG0; 2ZHE; 2ZHF; 2ZHW; 3BIU; 3BIV; 3F68; 3HAT; 3HTC; 3P17; 3QTO; 3QTV; 3QWC; 3QX5; 3RLW; 3RLY; 3RM0; 3RM2; 3RML; 3RMM; 3RMN; 3RMO; 3SHA; 3SHC; 3SI3; 3SI4; 3SV2; 3T5F; 3TU7; 3U98; 3U9A; 3UWJ; 4BAO; 4E7R; 4HTC; 4LOY; 4UD9; 4UDW; 4UE7; 4UEH; 4UFD; 4UFE; 4UFF; 4UFG; 5A2M; 5AF9; 5JFD; 5JZY; 5LCE; 5LPD; 5MJT; 5MLS; 5MM6; 6EO8; 6EO9; 6GBW; 6HSX; 6I51; 6ROT; 6T3M; 6T3Q; 6T4A; 6T52; 6T53; 6T54; 6T55; 6T56; 6T57; 6T89; 6T8A; 6TDT; 6Y02; 6Y9H; 6YB6; 6YHG; 6YHJ; 6YMP; 6YN3; 6YQV; 6YSJ; 6YSX; 6ZGO; 7AC9; |
| Mapped Pubmed ID | 10212123; 11053836; 11676542; 11738570; 15299843; 15658854; 16294249; 16480269; 17889527; 17902081; 1939071; 19520086; 22366545; 22612268; 23290007; 24175584; 25268757; 26270568; 26762840; 31633354; 32011145; 8136362; 8251938; 8367461; 8913620; 9226718; |
| Motif | |
| Gene Encoded By | |
| Mass | 7,571 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |