| IED ID |
IndEnz0002003620 |
| Enzyme Type ID |
protease003620 |
| Protein Name |
High frequency lysogenization protein HflD
|
| Gene Name |
hflD Z1861 ECs1604 |
| Organism |
Escherichia coli O157:H7 |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Enterobacteriaceae
Escherichia
Escherichia coli
Escherichia coli O157:H7
|
| Enzyme Sequence |
MAKNYYDITLALAGICQSARLVQQLAHQGHCDADALHVSLNSIIDMNPSSTLAVFGGSEANLRVGLETLLGVLNASSRQGLNAELTRYTLSLMVLKRKLSSAKGALDTLGNRINGLQRQLEHFDLQSETLMSAMAAIYVDVISPLGPRIQVTGSPAVLQSPQVQAKVRATLLAGIRAAVLWHQVGGGRLQLMFSRNRLTTQAKQILAHLTPEL |
| Enzyme Length |
213 |
| Uniprot Accession Number |
Q8X736 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Negative regulator of phage lambda lysogenization. Contributes to the degradation of the phage regulatory protein CII. Acts probably by holding CII on the membrane surface, away from the target promoters, but close to the FtsH protease. {ECO:0000255|HAMAP-Rule:MF_00695}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Coiled coil (1) |
| Keywords |
Cell inner membrane;Cell membrane;Coiled coil;Cytoplasm;Membrane;Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm. Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_00695}; Peripheral membrane protein {ECO:0000255|HAMAP-Rule:MF_00695}; Cytoplasmic side {ECO:0000255|HAMAP-Rule:MF_00695}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
22,947 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|