| IED ID |
IndEnz0002003634 |
| Enzyme Type ID |
protease003634 |
| Protein Name |
Hydrogenase expression/formation protein HoxM
|
| Gene Name |
hoxM PHG005 |
| Organism |
Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Betaproteobacteria
Burkholderiales
Burkholderiaceae
Cupriavidus
Cupriavidus necator (Alcaligenes eutrophus) (Ralstonia eutropha)
Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha)
|
| Enzyme Sequence |
MVVAMGIGNVLWADEGFGVRCIETLQQRYQFAPQVCLVDGGTQGLYLIHHVQAASRLLIFDAIDYGLPPGTLRIIEDEAVPKFLGAKKMSLHQTGFQEVLLLAQLTGQYPQQVVLIGCQPEELEDYGGSLRRVMKAAVEDAVEKGADLLRRWGGMPVPRTAELAPAEAVTVPHLALDRYEAERPSPRAACRIGDERFMPQDL |
| Enzyme Length |
202 |
| Uniprot Accession Number |
P31909 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Absolutely required for hydrogenase activity. Mediates the attachment of hydrogenase to the bacterial membrane; attachment is a requirement for enzymatic activity. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Metal binding (3) |
| Keywords |
Aspartyl protease;Hydrolase;Metal-binding;Nickel;Plasmid;Protease;Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
Plasmid megaplasmid pHG1 |
| Mass |
22,254 |
| Kinetics |
|
| Metal Binding |
METAL 15; /note=Nickel; /evidence=ECO:0000250; METAL 61; /note=Nickel; /evidence=ECO:0000250; METAL 92; /note=Nickel; /evidence=ECO:0000250 |
| Rhea ID |
|
| Cross Reference Brenda |
|