| IED ID | IndEnz0002003638 |
| Enzyme Type ID | protease003638 |
| Protein Name |
RxLR effector protein Avrblb2 Avirulence protein Avrblb2 |
| Gene Name | Avrblb2 PexRD39 PexRD40 PITG_20300 |
| Organism | Phytophthora infestans (strain T30-4) (Potato late blight fungus) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora infestans (Potato late blight agent) (Botrytis infestans) Phytophthora infestans (strain T30-4) (Potato late blight fungus) |
| Enzyme Sequence | MRSFLYGVLAFAVLARSSAVAAFPIPDESRPLSKTSPDTVAPRSLRIEAQEVIQSGRGDGYGGFWKNVAQSTNKIVKRPDIKIGKLIEAAKKAKAKMTKS |
| Enzyme Length | 100 |
| Uniprot Accession Number | D0P1A8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Secreted effector that acts as an elicitor of hypersensitive response (HR) specifically on plants carrying defense protein Rpi-blb2 (PubMed:19794118). Enhances P.infestans colonization of Nicotiana benthamiana leaves (PubMed:30329083). Interacts with, and subsequently prevents secretion into the apoplast of the host papain-like cysteine protease C14, thus promoting virulence by interfering with the execution of host defenses (PubMed:22143776). Associates with calmodulin at the host plasma membrane to interfere with plant defense-associated calcium signaling in hosts (PubMed:30984224). {ECO:0000269|PubMed:19794118, ECO:0000269|PubMed:22143776, ECO:0000269|PubMed:30329083, ECO:0000269|PubMed:30984224}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Motif (2); Mutagenesis (3); Signal peptide (1) |
| Keywords | Host cell membrane;Host membrane;Membrane;Reference proteome;Secreted;Signal;Virulence |
| Interact With | |
| Induction | INDUCTION: Expression is induced during host plant infection. {ECO:0000269|PubMed:28228125, ECO:0000269|PubMed:29312401}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:22143776, ECO:0000269|PubMed:30329083, ECO:0000269|PubMed:30984224}. Host cell membrane {ECO:0000269|PubMed:22143776, ECO:0000269|PubMed:30329083, ECO:0000269|PubMed:30984224}. Note=AVRblb2 localization is essential for its virulence function but not for its avirulence activity. {ECO:0000269|PubMed:22143776}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 43..57; /note=RxLR-dEER; /evidence=ECO:0000305|PubMed:19794118; MOTIF 78..82; /note=Calmodulin-binding motif; /evidence=ECO:0000269|PubMed:30984224 |
| Gene Encoded By | |
| Mass | 10,821 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |