| IED ID | IndEnz0002003641 |
| Enzyme Type ID | protease003641 |
| Protein Name |
Acyl carrier protein, mitochondrial ACP CI-SDAP NADH-ubiquinone oxidoreductase 9.6 kDa subunit |
| Gene Name | NDUFAB1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE |
| Enzyme Length | 156 |
| Uniprot Accession Number | O14561 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (PubMed:27626371). {ECO:0000250|UniProtKB:P52505, ECO:0000269|PubMed:27626371}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Domain (1); Erroneous initiation (1); Helix (5); Modified residue (2); Sequence conflict (1); Transit peptide (1); Turn (1) |
| Keywords | 3D-structure;Acetylation;Direct protein sequencing;Electron transport;Fatty acid biosynthesis;Fatty acid metabolism;Lipid biosynthesis;Lipid metabolism;Mitochondrion;Phosphopantetheine;Phosphoprotein;Reference proteome;Respiratory chain;Transit peptide;Transport |
| Interact With | Q08043; Q96PG8; Q5H9J7; Q8N4L8; P26441; Q9BSK4; Q13643; Q53EP0-3; Q9BQA5; Q7L273; P25791-3; Q8TBB1; Q6PF18; Q86UR1-2; Q16656-4; Q96HA8; O43482; Q969H6; Q96I34; P17980; Q9GZT3; Q9NVV9; O43711; Q96NM4-3; Q08AM6; P17023; Q86VK4-3; Q3KNS6-3 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:12611891, ECO:0000269|PubMed:28892042}. |
| Modified Residue | MOD_RES 88; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q9CR21; MOD_RES 112; /note=O-(pantetheine 4'-phosphoryl)serine; /evidence=ECO:0000255|PROSITE-ProRule:PRU00258 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1); Electron microscopy (26); X-ray crystallography (1) |
| Cross Reference PDB | 2DNW; 5OOL; 5OOM; 5XTB; 5XTC; 5XTD; 5XTH; 5XTI; 6ODD; 7A5H; 7A5J; 7O9K; 7O9M; 7ODR; 7ODS; 7ODT; 7OF0; 7OF2; 7OF3; 7OF5; 7OF7; 7OI6; 7OI7; 7OI8; 7OI9; 7OIC; 7OID; 7OIE; |
| Mapped Pubmed ID | 11695836; 12231006; 12837546; 12882974; 14741580; 15250827; 16230336; 17554300; 17601350; 18230186; 18977241; 19221180; 19343046; 19570983; 20552642; 20877624; 21924235; 21930947; 21988832; 23270816; 24191001; 24344204; 28844695; 29983374; 31664822; 33243891; 34135318; 34135319; 34135320; 34315873; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,417 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |